125+ Popular Hashtags for Instagram for Viral Posts

 

Popular Hashtags for Instagram for Viral Posts

Instagram is a fast growing social media with billions of users. Making your posts viral is tough task but if you use these popular hashtags for Instagram for viral posts, you can make your post viral within weeks. These popular hashtags are extracted and filtered from Instagram itself. Using these famous hashtags will increase reach of your posts and bring you closer to your Instgram growth goals.

Popular hashtags for Instagram Reels

Popular hashtags for Instagram reels are used to increase the reach of your Reels short videos on Instagram. Includign these popular hashtags in your posts will give a boost to your reels impressions and increase the chance of getting new followers, likes and comments. 

Following are the three set of well refines popular hashtags for Instagram Reels. You can try any of the set and copy paste it in your post description. 

Popular hashtags for Instagram Reels  Set 01

#videocomment #videocomments #videocommentée #videocommentary #commentvideo #commentvideo❤️ #commentfaireunevideo #commentvideo❤️❤️ #likecommentsharethisvideo #commentforvideo #commentthisvideo #commentaryvideo #commentvideos #likevideocomment

Popular hashtags for Instagram Reels Set 02

#likethisvideo #videolikevideo #likeofficialvideo #videoyoumightlike #videolikeforlike #likethisvideo❤️ #likethevideo #likemagicvideo #likeforvideo #likeyoutubevideo #postvideobylikethisismystyle #videolikemix #wamboesbelikevideos #likeforlikevideo #instalikevideo #likemevideo #likeevideos

Popular hashtags for Instagram Reels Set 03

#reelslikefollowreelsinstagramdreelsvirallikefollowroyalbealikefollowinstagrmsupport♥️♥️♥️♥️ #reelslikekarofeelkaro #reelslikefeels #reelslikecommentsharefollow😉 #ʀᴇᴇʟsʟɪᴋᴇs #reelslikers #reelslikeandfollowmeplease❤️❤️ 

Popular hashtags for Instagram Post

Popular hashtags for Instagram post set 01

instagramstorypost #instagramstoryinspo #instagramstorydesign #instagramstories❤ #instagramstoryhighlights #instagramstorytutorial #instagramstorystickers #instagramstorycovers #instagramstorytricks #instagramstoryedits #instagramstoriesанилорак #instagramstoryhack

Popular hashtags for Instagram post set 02

#instagramstopblokingfanaccounts #instagramstop #storyinstagram #storiesinstagram #instagramstopcroppingmyphotos #instagramstoryconchitawurst #instagramstories😍❤ #instagramstory👼 #instagramstories🍀🍀🍀 #instagramstories🎥 #instagramstonegem

Popular hashtags for Instagram post set 03

#tapdouble #zombielanddoubletap #doubletapplease #doubletapdatass #doubletapyourside #doubletaptactical®️ #doubletaptuesday #doubletaptolike #doubletapthis #doubletapifyoulikeit #doubletapfordoubletap 

Popular hashtags for Instagram Pic

Instagram is a picture oriented social media on which we mostly post photos and videos. But to get more engagement and followers you need these popular hashtags for Instagram pic. Including instagram hashtag will increase the reach of your Instagram posts which ultimately encourage more people to follow your account.

You can use any set of the following popular hashtags for Instagram pic. These sets of hashtags can work will all kinds of niche and give good results. Try to mix different hashtags if it works for you but make sure you don't use more than 30 hashtags in your post description.


Popular hashtags for Instagram pic set 01

#likenowlike #likenoway #likenownow #likenowme #likenow15likes #likenowplz #likenowhereonearth #likenowpls #likenowhereelseintheworld #likenowwww #likenowplese #likenowhereels #likenowwwww #likenowlol #likenowtho #likenow

Popular hashtags for Instagram pic set 02

#100klikesforlikes #100klikerss #100kliles #100klikealways #100kliker #100klikesme #100klikesin24hours #100klicu #100klikess #100klikeforfllow #100klifestyle #likee100kgiveaway #100klives

Popular hashtags for Instagram pic set 03

#commentphotos #commentphotoshoot #commentphotosuggestions #commentmyphotos #commentphotosonfacebook #commentphotoshopersonexistence #pornhubcommentsonstockphotos #likeandcommentonallphotos #commentonmyphotos #comment4photos



Popular hashtags for Instagram Motivation

Popular hashtags for Instagram Motivation includes hashtags mainly for the instagram page which post motivational thoughts, motivational quotes, inspirational reels, and encouraging pictures for the audience. This kind of instagram account are getting very popular these days. 

But with the increase in the number of motivational instagram accounts, its become hard to grow your instagram followers and get more likes on your posts. That's why you need the right set of popular hashtags for Instagram motivational pages. 

Here we extracted and filtered out a collection of popular hashtags that can help increasing reach of the post to a broader audience and increase the chance of getting new followers.

Popular hashtags for Instagram Motivation set 01

#motivationiskey #motivationalquotesoftheday #fitnessmotivation #motivationalspeech #motivationalposts #gymmotivation #motivations #motivationalquoteoftheday #motivationssprüche #motivationalsayings #motivationalpost #motivationalpage

Popular hashtags for Instagram Motivation set 02

#inspirationalquotes #inspiration #inspirational #inspirationtattoo #inspirations #inspiratie #inspirationalquote #inspirationalwords #inspirationquotes #inspirationbusiness #inspirationcultmag #inspirationalthoughts #inspiratif #inspirationalwomen #inspirationalquotesandsayings

Popular hashtags for Instagram Motivation set 03

#motivationalspeaker #motivationalspeech #motivationalspeakers #motivationalspeaking #motivationalspeeches #motivationalspeechtamil #motivationalspeaker🎤 #motivationalspeechinhindi #motivationalspeakerinthemaking #motivationalspeakerbusiness 

Popular hashtags for Instagram Today

Popular hashtags for Instagram today is a list of well curated hashtags that can be used with your daily posting on Instagram. It can help you grow new followers and more engagement on Instagram easily. 

Regular posting is a key to success on Instagram. Some Instagram account even post 2-4 times in a day. So if you don't post daily you are lacking behind. First thing you need to do today is to post story and then share atleast 2 post on your Instagram account. Secondly, you can use one of the set of these hashtags in your post to increase the engagement today


Popular hashtags for Instagram Today Set 01

#trendingpostoninsta #třendingposts #trendingposte #trendingposts🔥😇😇 #trendingpost97 #trendingposter #trendingpostsvirall #trendingpostnow #trendingpostvibes #trendingpostofbts #trendingpostoninstagram #trendingpostinstagood 

Popular hashtags for Instagram Today Set 02

#trendingstories #trendingstories🔥🔥 #trendingstoriez #trendingstoriestakingover #trendingstorie #trendingstori #trendingnationstories #trendingstories🥰😘 #socialitestrendingstories #trendingstoriesnaganganainfochannel 

Popular hashtags for Instagram Today Set 03

#trendingstoriesepisode #trendingstoriesofpakistan #trendingstoriesinhindiurdu #trendingstorieszzzz #trendingstoriesbouttechnology #alltrendingstories #trendingbollywoodstories #trendingstories🥰 #mytrendingstories



Popular hashtags for Instagram Photography

Photography is a passion for some people and there's no better place than Instagram to grow their fan following. You can start posting pictures and videos of your photography including these popular hashtags for Instagram Photography. 

These popular photography hashtags are extracted from Instagram famous and most popular accounts which has proven growth of followers, likes and shares on their Instagram account. Same way you can get instant growth of followers using any one set of following popular hashtags for Instagram Photography.

Popular hashtags for Instagram Photography set 01

#popularreels #popularreelsvideo #popularreels❤️ #popularreels❤️😍 #popularreelsvideoinstareelsindia❤️instafav #popularreelscretor #popularreelsininstagram #popularreelsexploer #popularreelsvideoinstareelsindia❤️instafavrt #̲p̲o̲p̲u̲l̲a̲r̲r̲e̲e̲l̲s̲

Popular hashtags for Instagram Photography set 02

#popularvideos❤️ #popularvideo #popularvideoclip #popularvideo2020 #popularvideosoof #popularmusicvideo #popularvideooftheday #popularvidei #popularvideo❤ #popularvideo

Popular hashtags for Instagram Photography set 03

#popularvideos #popularvideogame #popularvidz #popularvideocake #popularvideography #popularvideoes #popularvideoshoot #popularvideoreels #popularvideocreator #vidalmayoríapopular



Popular hashtags for Instagram Bio

Instagram Bio has a vital role in making an Instagram account discoverable. If you have hashtag rich Instagram Bio then your account is most likely to be found by your desired audience. You can include these popular hashtags for Instagram Bio to increase the reach of your Instagram account. 

Instagram Bio should always be written considering the niche of your account and with suitable and popular hashtags that are mostly searched by the audience in Instagram. The following 3 sets of hashtags can be included with anykind of niche. These hashtags are will make your Instagram account search friendly. 

Popular hashtags for Instagram Bio set 01

#popularpict #popularpicturing #popularpickoftheday #popularpicphoto #popularpicq #popularpice #popularpicg #popularpicsbvinstadaily #popularpica #popularpicsoftheday #popularpictureoftheday

Popular hashtags for Instagram Bio set 02

#mostpopular #popularsongs #popularity #popularanime #popularmeme #musicapopular #popularreels #instapopular #popularart #popularnails #populartagsapp #popularstar #popularphotos #popularmonster #populartags #populartasik #populargirl #popularculture #popularpugs #populardemand

Popular hashtags for Instagram Bio set 03

#popular #popularpic #popularphoto #popularpage #populardancetrends #popularnow #popularwoodworking #popularphot #popularmagazine #popularhashtags #popularsong #populartv #popularmemes #populares #popularvideos #popularvideo #popularphoto

Most Popular Hashtags on Instagram

If the above hashtags doesn't fit your needs you can try these most popular hashtags on Instagram which has been collected from the best performing Instagram accounts and probably proven for increasing your followers on Instagram. 

You can include these popular instagram hashtags in your posts description, in your reeels, videos, stories and in Instagram bio. Try to make a combination of hashtags from this entire blog to find out which one works for you. 


Popular Hashtags to Use on Instagram

We have already seen a lot Popular hashtags to use on Instagram through out this article but the list doesnot ends here. We have found some more popular hashtags to use on instagram here from some fastest growing accounts.

Inculding these popular hashtags in your post description, reels, videos and stories, you can boost the audience reach easily and will help in growing your followers as soon as possible.

You can combile these hashtags with other tags mentioned in this blog post to find the best set of popular hashtags to use on Instagram. 

#popularpict #popularpicturing #popularpickoftheday #popularpicphoto #popularpicq #popularpice #popularpicg #popularpicsbvinstadaily #popularpica #popularpicsoftheday #popularpictureoftheday

Most Popular Hashtags on ig

Instagram is also abbreviated as ig which means the same but the word 'ig' is also use as the most popular hashtags on ig( Instagram). You can use these most popular hashtags on ig with any kind of posts, reels, and videos because these hashtags fits with any niche possible.

We recommend to include at least five of these most popular hashtags on ig posts because it will make your audience a little bit broader which is good to include instagram users who are interested in multiple categories posts. 



Most Popular ig tags

Continuing the above list of most popular ig tags, here we list up more tags that will be helpul for growing engagement on your content on Instagram. Why we call these tags as the most popular ig tags is because they have given assured results to instagram accounts that used them earlier.

Its better to include to include atleast one set of these most popular ig tags with the combination to tags related to your niche on Instagram. It will surely increase the chance of getting more profile visits on your Ig account. 

Popular ig hashtags for likes

Sometimes even consistent posting doesn't give you best results in terms of likes. This is because there are specific popular ig hashtags for likes on Instagram. We have created a separate list of these popular ig hashtags for likes for you to copy and paste it into your post description. 

These popular ig hashtags for likes is one the best set of hashtags that helps your content to be shown to a audience who are most likely to like your post. If you are aiming for likes for your instagram posts then these popular ig hashtags for like is going to be your game changer. 

Popular ig hashtags for likes set 01

#virallike #virallikebums #virallikevidios #virallikenow #virallikee #virallikes #virallikesupportfollow #virallikesupportfollow💪💯 #virallikesforlike #virallike❤️ #virallike1000k #likeviral #virallikevirus #virallikeyourmom 

Popular ig hashtags for likes set 02

#virallikesupportfollow💪 #viralpostlikefollow #likeviralhastags #viralvideo100like #likeappviral #viralmypost♥️like #likeviralvideo❤️ #likeviralvideo #viral1klike #viralike #viral1millionlike #likeandviralreels♥️

Popular hashtags for likes on instagram

Continuing the popular hashtags for likes on Instagram list, we added a couple more sets of these hashtags to try with your Instagram posts. Although, it is not needed to use all these popular hashtags for likes on Instagram yet you should include atlease 5 to 10 hashtags that suits your niche better.

It is not easy to get likes on Instagram due to high competition that's using these filtered set of popular hashtags for likes on Instagram is going to help your post stand out to the right audience.

Popular hashtags for like on Instagram Set 01

#likevideo #likevideos #likevídeo #likevideoapp #likevideoindonesia #videolike #likevideos❤️❤️ #likevideolike #likevideostudio #likevídeos #likevideoini #likevideo😊😊🙈🙈 #likevideohit #likevideo😊 #womanlikemevideo #likeappvideo #likevideos❤️ #likevideome #likemyvideo

Popular hashtags for like on Instagram Set 02

#likethisvideo #videolikevideo #likeofficialvideo #videoyoumightlike #videolikeforlike #likethisvideo❤️ #likethevideo #likemagicvideo #likeforvideo #likeyoutubevideo #postvideobylikethisismystyle #videolikemix #wamboesbelikevideos #likeforlikevideo #instalikevideo #likemevideo #likeevideos

Popular hashtags for instagram post

If you have the instagram account that mostly work on posts not reels then these popular hashtags for Instagram post will help you reach your engagement goals. Posts are made more engagement on Instagram, it not just increase the interaction but also boost your profile visits. That's why its necessary that your posts reaches a broad audience.

To achieve this goal you need to focus on what kind of hashtags are you using. In case you are not sure about it, you can just copy and past the following set of popular hashtags for instagram posts. We have tested these set of hashtags with all kinds of content on Instagram and most of them perform extraordinary.

Popular hashtags for Instagram post set 01

#commentdownbelow👇🏽 #commentdownyourfavorite #commentdownbelowifulikeit #commentdownhowsit #commentdownonit #commentdownyouranswer #commentdownyourrviews #commentdownbelowforreviews #commentdown❤️ #commentdownbelow⬇️👇 #commentdownbelowyouranswer #commentdownyourfav

Popular hashtags for Instagram post set 02

#commentsreels #reelspleaselikecommentsandfollow #commentsmyreels #newreelslikecommentandshare #reelsforcomment #reelslikecommentsharefollow #reelslikecommentsharefollowl #commentmyreels #commentreelsfeelit

Frequently Asked Question for Popular hashtags for Instagram

What Instagram hashtags get the most likes?

Instagram hashtags which get the most likes is different for every one but surely you can find some of the popular hashtags in this blog post to help you get a good start. 

Which hashtag has highest post on Instagram?

#likeforlike is a hashtags which has more than a billion of posts on Instagram. There are bunch of other tags too you can explore them in this blog post. Number of posts on certain hashtags is clear indicator that the hashtag is performing well but you need to be careful of some other factor before using any hashtags. For that you can read the this article 9 Important Things to Know Before Choosing A Hashtag

What hashtags get you famous on Instagram?

There are alot of hashtags that can make you famous but it can be different for everyone depending on your niche and type of content you post. Make sure you should clearly fix your category and then try to find some popular hashtags for it. We have already list up alot of popular hashtags for Instagram in this blog post. Try to include some of them to see if it works with your content.

How do I find trending hashtags?

To find trending hashtags try to research the accounts which post the same type of content like yours, secondly keep an eye on trending news in your category, sometimes trending hashtags came out of latest news. Being aware is the only way to find trending hashtags.

How to create a hashtag?

For creaiting hashtag you need to use "#" symbol followed by your tag name. For e.g #Bestvideooftheday or #GameroftheWeek. Make sure your hashtag is related to the context of your content. Irrelevant hashtags may lead your post to non-interested audience.

Where to find viral hashtags?

To find viral hashtags stick to the latest trends, news and storeis happening in your domain. Often times viral hashtags comes out of these trends. Other than than you can read our blog posts to stay updated with the list of popular hashtags for Instagram.

Do trending hashtags work?

Yes. Trending hashtags work if it is used correctly. Trending hashtags can give a growth in  your audience with the raising trend of that particular tag. Stay connected with our blog post to get a list of trending hashtags that actually work.

Should I use all 30 hashtags?

The straight answer is No. You should never try to include more than 20 hashtags in one single post. Instagram has a limit of 30 hashtags but including 30 hashtags make your audience too broad and your post get visibile to the people who are not even interested to your content. 

Can a hashtag go viral?

Yes. Any hashtag can go viral but it depends on multiple factors like news, content engagement, promotion etc. You just need to try some to the popular hashtags for Instagram to make your post viral.

Do reels need hashtags?

Probably yes. It has been examined that certain reel performs differently with or without hashtags. So always make sure you include some of the popular Instagram hashtags to your reel to make it viral.

Post a Comment

Previous Post Next Post